PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g69185.3.p
Common NameBRADI_1g69185, LOC100834986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 134aa    MW: 15367.6 Da    PI: 9.2151
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g69185.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1964123257
                       T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC...TS-HHHHHHHHHHHHHHHHC CS
          Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl...gLterqVkvWFqNrRakekk 57 
                       r+R+t+t+ ql++Le+ F + n +ps++++++++++l   g  e++V++WFqNrRa+ k+
  Bradi1g69185.3.p  64 RQRWTPTQMQLQILESIFDQgNGTPSKQKIKDITAELsqhGQIETNVYNWFQNRRARSKR 123
                       89*****************99****************99978899*************97 PP

2Wus_type_Homeobox98.64.8e-3263125265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPt+ Q++iLe+++++G  tP+k++i++itaeL+++G+ie +NV++WFQNr+aR+++kq
   Bradi1g69185.3.p  63 ARQRWTPTQMQLQILESIFDQGNGTPSKQKIKDITAELSQHGQIE-TNVYNWFQNRRARSKRKQ 125
                        789*****************************************7.7***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-1558127IPR009057Homeodomain-like
PROSITE profilePS5007114.04260124IPR001356Homeobox domain
SMARTSM003891.9E-1362128IPR001356Homeobox domain
SuperFamilySSF466891.67E-1563126IPR009057Homeodomain-like
PfamPF000461.6E-1764123IPR001356Homeobox domain
CDDcd000863.52E-1164125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
MEVMTDEQME VLRKQISIYA IICEQLVEMH RALTAHQDSI AGMRLGNLYC DPLMVHGGHK  60
ITARQRWTPT QMQLQILESI FDQGNGTPSK QKIKDITAEL SQHGQIETNV YNWFQNRRAR  120
SKRKQAAFLP NNT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARSKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7131721e-135KJ713172.1 Stipa purpurea WOX13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753228.16e-98PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM32e-86WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A0Q3HJ926e-98A0A0Q3HJ92_BRADI; Uncharacterized protein
STRINGBRADI2G53390.17e-89(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.14e-66WUSCHEL related homeobox 13